PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 375aa    MW: 40235.8 Da    PI: 7.476
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447763.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r + + Rt+ q+ s+ qky
   XP_016447763.1 118 PWTEEEHRLFLLGLQKLGKGDWRGISRNFVTSRTPTQVASHAQKY 162
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.9E-4223IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.515319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.642111167IPR017930Myb domain
SuperFamilySSF466892.32E-17113168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-18114166IPR006447Myb domain, plants
SMARTSM007172.6E-11115165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11115161IPR009057Homeodomain-like
CDDcd001671.57E-9118163No hitNo description
PfamPF002495.9E-11118162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MTRRCSHCNN NGHNSRTCPT TRGGATTGGV GGSSGSGGAS GGVRLFGVRL TDGSIMKKSA  60
SMGNLSSLHS YHSSSSPNPP GSPSSDVPHL PDGYLSDDPN THASISANRR LERKKGVPWT  120
EEEHRLFLLG LQKLGKGDWR GISRNFVTSR TPTQVASHAQ KYFIRQSNAT RRKRRSSLFD  180
IVADTGTDAS HPLPEEQFML PPRAVESDKE HLAPSATKAI ETDFADSLPS LDLSLKSDFE  240
SMETTPTEPV EGTKPNTSTN EIPSVYPAFF PAYIPVPYSF WPSNAVPVPE DRGAEPSHHQ  300
ILKPIPTVPK EPVNVDELVG MSQLTLADAG SGHIEPSPLS LKLTAEPSRQ SAFHASTPVK  360
SSEITKGETA PIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016447763.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLK4DFE70.0K4DFE7_SOLLC; Uncharacterized protein
STRINGSolyc12g044610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-74MYB_related family protein